Overview

  • Product nameRecombinant Human ASAH1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13510
    • SpeciesHuman
    • SequencePPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLK VIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD
    • Molecular weight37 kDa including tags
    • Amino acids25 to 124

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AC
    • ACDase
    • Acid CDase
    • Acid ceramidase
    • Acid ceramidase precursor
    • Acid ceramidase subunit beta
    • Acylsphingosine deacylase
    • ASAH
    • ASAH 1
    • ASAH1
    • ASAH1_HUMAN
    • FLJ21558
    • FLJ22079
    • N acylsphingosine amidohydrolase
    • N acylsphingosine amidohydrolase (acid ceramidase) 1
    • N acylsphingosine amidohydrolase 1
    • N-acylsphingosine amidohydrolase
    • N-acylsphingosine deacylase
    • PHP
    • PHP32
    • Putative 32 kDa heart protein
    • SMAPME
    see all
  • FunctionHydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
  • Tissue specificityBroadly expressed with highest expression in heart.
  • Involvement in diseaseDefects in ASAH1 are the cause of Farber lipogranulomatosis (FL) [MIM:228000]; also known as Farber disease (FD). This sphingolipid disease is characterized by subcutaneous lipid-loaded nodules, excruciating pain in the joints and extremities, marked accumulation of ceramide in lysosomes, and death by three years of age.
  • Sequence similaritiesBelongs to the acid ceramidase family.
  • Cellular localizationLysosome.
  • Information by UniProt

Recombinant Human ASAH1 protein images

  • 12.5% SDS-PAGE showing ab114948 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human ASAH1 protein (ab114948)

ab114948 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"