Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIE WLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEP LKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLT LQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTM SYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFL LVWLLIRRKDKERYEEEERPNEIREDAEAPKARLVKPSSSSSGSRSSRSG SSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHH ANLTKAETTPSMIPSQSRAFQTV
    • Amino acids
      1 to 373
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACAM
    • Adipocyte adhesion molecule
    • Adipocyte specific adhesion molecule
    • ASAM
    • CAR like membrane protein
    • CAR-like membrane protein
    • CLMP
    • CLMP_HUMAN
    • Coxsackie and adenovirus receptor like membrane protein
    • Coxsackie- and adenovirus receptor-like membrane protein
    • Coxsackievirus- and adenovirus receptor-like membrane protein
    • CSBM
    • CSBS
    • CXADR like membrane protein
    • CXADR-like membrane protein
    • FLJ22415
    • PRO363
    • UNQ318
    see all
  • Function
    May be involved in the cell-cell adhesion. May play a role in adipocyte differentiation and development of obesity.
  • Tissue specificity
    Predominantly expressed in epithelial cells within different tissues and in the white adipose tissue. Expressed at high levels in small intestine and placenta, at intermediate levels in the heart, skeletal muscle, colon, spleen, kidney and lung and at low levels in the liver and peripheral blood leukocytes.
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • ab164126 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164126 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up