Recombinant Human ASAP1 / DDEF1 protein (ab162357)

Overview

  • Product name
    Recombinant Human ASAP1 / DDEF1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQ ADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
    • Amino acids
      1030 to 1129
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 130 kDa phosphatidylinositol 4
    • 130 kDa phosphatidylinositol 4 5 biphosphate dependent ARF1 GTPase activating protein
    • 5-biphosphate-dependent ARF1 GTPase-activating protein
    • ADP ribosylation factor directed GTPase activating protein 1
    • ADP-ribosylation factor-directed GTPase-activating protein 1
    • AMAP 1
    • AMAP1
    • ANK repeat and PH domain-containing protein 1
    • ARF GTPase activating protein 1
    • ARF GTPase-activating protein 1
    • Arf-GAP with SH3 domain
    • ASAP 1
    • ASAP1
    • ASAP1_HUMAN
    • Centaurin beta 4
    • CentB4
    • DDEF 1
    • DDEF1 protein
    • DEF-1
    • Development and differentiation enhancing factor 1
    • Development and differentiation-enhancing factor 1
    • Differentiation-enhancing factor 1
    • KIAA1249
    • PAG 2
    • PAG2
    • PAP
    • PIP2 dependent ARF1 GAP
    • PIP2-dependent ARF1 GAP
    • ZG 14P
    • ZG14P
    see all
  • Function
    Possesses phosphatidylinositol 4,5-biphosphate-dependent GTPase-activating protein activity for ARF1 (ADP ribosylation factor 1) and ARF5 and a lesser activity towards ARF6. May coordinate membrane trafficking with cell growth or actin cytoskeleton remodeling by binding to both SRC and PIP2. May function as a signal transduction protein involved in the differentiation of fibroblasts into adipocytes and possibly other cell types (By similarity). Plays a role in ciliogenesis.
  • Sequence similarities
    Contains 2 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Domain
    The PH domain most probably contributes to the phosphoinositide-dependent regulation of ADP ribosylation factors.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues by SRC.
  • Cellular localization
    Cytoplasm. Membrane. Predominantly cytoplasmic (By similarity). Partially membrane-associated.
  • Information by UniProt

Images

  • ab162357 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up