Overview

  • Product name
    Recombinant Human ASAP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQA ILQRIKKAVRAIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFL NLAVFTREVAALFKNLIQNLNNIVSFPLDSLMKGQLRDGRQDSKKQLEKA WKDYEAKMAKLEKERDRARVTGGIPGEVAQDMQRERRIFQLHMCEYLLKA GESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFIEKLAASVHAL HQAQEDELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQ FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLT CQVRPNPEEKKCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSA FLGEPSAGPGSWGSAGHDGEPHDLTKLLIAEVKSRPGNSQCCDCGAADPT WLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNT SFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQR LWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQA SLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGT VNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGS DSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESED CPPPLPVKNSSRTLVQGCARHASGDRSEVSSLSSEAPETPESLGSPASSS SLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPSEMYLPVRFSS ESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQL LQD
    • Amino acids
      1 to 903
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9430088F20Rik
    • ACAP4
    • ANK repeat and PH domain-containing protein 3
    • Arf GAP with SH3 domain
    • Arf GAP with SH3 domain, ANK repeat and PH domain containing protein 3
    • Arf-GAP with SH3 domain
    • ARF6 GTPase activating protein
    • ArfGAP with SH3 domain, ankyrin repeat and PH domain
    • ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 1
    • ASAP3
    • ASAP3_HUMAN
    • BOS_2358
    • Centaurin, beta 6
    • CENTB6
    • DDEFL1
    • Development and differentiation enhancing factor like 1
    • Development and differentiation-enhancing factor-like 1
    • FLJ20199
    • Gm140
    • MGC102639
    • MGC155101
    • OTTMUSP00000010435
    • Protein up-regulated in liver cancer 1
    • RP23-118A9.4
    • Up regulated in liver cancer 1 (UPLC1)
    • UPLC1
    see all
  • Function
    Promotes cell proliferation.
  • Tissue specificity
    Highly expressed in primary hepatocarcinoma. Detected in lung, liver and blood leukocytes.
  • Sequence similarities
    Contains 2 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 PH domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163148 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up