Overview

  • Product name
    Recombinant Human ASB10 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTAS GPALAFWQAVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNI RALRLW
    • Amino acids
      48 to 153
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ankyrin repeat and SOCS box containing 10
    • Ankyrin repeat and SOCS box protein 10
    • Ankyrin repeat- and SOCS box-containing protein 10
    • ASB 10
    • ASB-10
    • ASB10
    • ASB10_HUMAN
    • GLC1F
    see all
  • Function
    May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 7 ANK repeats.
    Contains 1 SOCS box domain.
  • Domain
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.
  • Information by UniProt

Images

  • ab165398 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up