Overview

  • Product name
    Recombinant Human ASB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTRFSYAEYFSLFHSCSAPSRSTAPPESSPARAPMGSFQGVMQKYSSSLF KTSQLAPADPLIKAIKDGDEEALKTMIKEGKNLAEPNKEGWLPLHEAAYY GQVGCLKVLQRAYPGTIDQRTLQEETAVYLATCRGHLDCLLSLLQAGAEP DISNKSRETPLYKACERKNAEAVKILVQHNADTNHRCNRGWTALHESVSR NDLEVMQILVSGGAKVESKNAYGITPLFVAAQSGQLEALRFLAKYGADIN TQASDNASALYEACKNEHEEVVEFLLSQGADANKTNKDGLLPLHIASKKG NYRIVQMLLPVTSRTRIRRSGVSPLHLAAERNHDEVLEALLSARFDVNTP LAPERARLYEDRRSSALYFAVVNNNVYATELLLQHGADPNRDVISPLLVA IRHGCLRTMQLLLDHGANIDAYIATHPTAFPATIMFAMKCLSLLKFLMDL GCDGEPCFSCLYGNGPHPPAPQPSSRFNDAPAADKEPSVVQFCEFVSAPE VSRWAGPIIDVLLDYVGNVQLCSRLKEHIDSFEDWAVIKEKAEPPRPLAH LCRLRVRKAIGKYRIKLLDTLPLPGRLIRYLKYENTQ
    • Amino acids
      1 to 587
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ankyrin repeat and SOCS box 2 containing protein
    • Ankyrin repeat and SOCS box containing 2
    • Ankyrin repeat and SOCS box containing protein 2
    • Ankyrin repeat and SOCS box containing protein 2a
    • Ankyrin repeat and SOCS box protein 2
    • Ankyrin repeat containing protein ASB2
    • ASB 2
    see all
  • Relevance
    The ankyrin repeat and SOCS box containing (ASB) protein family is comprised of members which each contain "SOCS boxes" but differ from other families of protein in the motifs they contain upstream of the SOCS box. SOCS boxes are carboxy terminal regions of homology found in the suppressor of cytokine signaling family of proteins. The box region is thought to be the point of interaction between SOCS proteins and E3 ubiquitin ligases. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. The gene is induced by all trans retinoic acid. In myeloid leukemia cells, the expression of this encoded protein has been shown to induce growth inhibition and chromatin condensation. Multiple alternatively spliced transcript variants have been described for this gene but their full length sequences are not known.
  • Cellular localization
    Cytoplasmic

Images

  • ab162633 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up