Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VINLIGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKNGTMPR EVARDPQLCEKLTVLCSAPGTLKTLARYAVRRSLGLQYLPDAVKGLPLPA SLKEYLLLLE
    • Amino acids
      179 to 288
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ankyrin repeat and SOCS box containing 8
    • Ankyrin repeat and SOCS box protein 8
    • ASB 8
    • ASB-8
    • ASB8
    • ASB8_HUMAN
    • FLJ21255
    • MGC5540
    • OTTHUMP00000237000
    • OTTHUMP00000237001
    • OTTHUMP00000237007
    • OTTHUMP00000237009
    • OTTHUMP00000237010
    • PP14212
    see all
  • Function
    May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificity
    Highest level of expression in skeletal muscle. Also expressed in heart, brain, placenta, liver, kidney and pancreas.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 4 ANK repeats.
    Contains 1 SOCS box domain.
  • Domain
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab165453 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up