Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH INWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESH MDCM
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 204

Specifications

Our Abpromise guarantee covers the use of ab132261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anti silencing function 1A
    • Anti-silencing function protein 1 homolog A
    • ASF1 anti silencing function 1 homolog A
    • ASF1 anti silencing function 1 homolog A (S. cerevisiae)
    • asf1a
    • ASF1A_HUMAN
    • CCG1 interacting factor A
    • CCG1-interacting factor A
    • CGI 98
    • CIA
    • hAsf1
    • hAsf1a
    • hCIA
    • Histone chaperone ASF1A
    • HSPC146
    see all
  • Function
    Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly and with HIRA to promote replication-independent chromatin assembly. Required for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the ASF1 family.
  • Post-translational
    modifications
    Phosphorylated by TLK1 and TLK2. Highly phosphorylated in S-phase and at lower levels in M-phase.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132261 stained with Coomassie Blue.

References

ab132261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up