Recombinant Human Asialoglycoprotein Receptor 2 (ab116745)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAKDFQDIQQLSSEENDHPFHQGPPPAQPLAQRLCSMVCFSLLALSFNIL LLVVICVTGSQSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDK ITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQR TCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQRFI VQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWRGHELGG SEDCVEVQPDGRWNDDFCLQVYRWVCEKRRNATGEVA
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 287

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ASGP R
    • ASGP-R 2
    • ASGPR 2
    • ASGPR2
    • Asgr2
    • ASGR2_HUMAN
    • Asialoglycoprotein receptor 2
    • C type lectin domain family 4 member H2
    • C-type lectin domain family 4 member H2
    • CLEC4H2
    • HBxAg-binding protein
    • HBXBP
    • Hepatic lectin 2
    • Hepatic lectin H2
    • Hepatic lectin R2/3
    • HL-2
    • Hs.1259
    • L H2
    • LH2
    • MGC108546
    • MHL 2
    • RHL2
    see all
  • Function
    Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
  • Tissue specificity
    Expressed exclusively in hepatic parenchymal cells.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab116745 at approximately 57.31kDa, stained with Coomassie Blue.

References

ab116745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up