Recombinant Human Asialoglycoprotein Receptor 2 (ab116745)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP07307
    • SpeciesHuman
    • SequenceMAKDFQDIQQLSSEENDHPFHQGPPPAQPLAQRLCSMVCFSLLALSFNIL LLVVICVTGSQSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDK ITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQR TCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQRFI VQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWRGHELGG SEDCVEVQPDGRWNDDFCLQVYRWVCEKRRNATGEVA
    • Molecular weight57 kDa including tags
    • Amino acids1 to 287

Specifications

Our Abpromise guarantee covers the use of ab116745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ASGP R
    • ASGP-R 2
    • ASGPR 2
    • ASGPR2
    • Asgr2
    • ASGR2_HUMAN
    • Asialoglycoprotein receptor 2
    • C type lectin domain family 4 member H2
    • C-type lectin domain family 4 member H2
    • CLEC4H2
    • HBxAg-binding protein
    • HBXBP
    • Hepatic lectin 2
    • Hepatic lectin H2
    • Hepatic lectin R2/3
    • HL-2
    • Hs.1259
    • L H2
    • LH2
    • MGC108546
    • MHL 2
    • RHL2
    see all
  • FunctionMediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
  • Tissue specificityExpressed exclusively in hepatic parenchymal cells.
  • Sequence similaritiesContains 1 C-type lectin domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Asialoglycoprotein Receptor 2 images

  • 12.5% SDS-PAGE analysis of ab116745 at approximately 57.31kDa, stained with Coomassie Blue.

References for Recombinant Human Asialoglycoprotein Receptor 2 (ab116745)

ab116745 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"