Overview

  • Product name
    Recombinant Human ASMTL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKAS FATPYGYAMETAKQKALEVANRLYQKDLRAPDVVIGADTIVTVGGLILEK PVDKQDAYRMLSRLSGREHSVFTGVAIVHCSSKDHQLDTRVSEFYEETKV KFSELSEELLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFP LNHFCKQLVKLYYPPRPEDLRRSVKHDSIPAADTFEDLSDVEGGGSEPTQ RDAGSRDEKAEAGEAGQATAEAECHRTRETLPPFPTRLLELIEGFMLSKG LLTACKLKVFDLLKDEAPQKAADIASKVDASACGMERLLDICAAMGLLEK TEQGYSNTETANVYLASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTN QHHRALGKKAEDLFQDAYYQSPETRLRFMRAMHGMTKLTACQVATAFNLS RFSSACDVGGCTGALARELAREYPRMQVTVFDLPDIIELAAHFQPPGPQA VQIHFAAGDFFRDPLPSAELYVLCRILHDWPDDKVHKLLSKVAESCKPGA GLLLVETLLDEEKRVAQRALMQSLNMLVQTEGKERSLGEYQCLLELHGFH QVQVVHLGGVLDAILATKVAP
    • Amino acids
      1 to 621
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acetylserotonin N methyltransferase like
    • Acetylserotonin O methyltransferase like
    • ASML_HUMAN
    • ASMTL
    • ASMTLX
    • ASMTLY
    • ASTML
    • N acetylserotonin O methyltransferase like protein
    • N-acetylserotonin O-methyltransferase-like protein
    see all
  • Function
    Unknown. The presence of the putative catalytic domain of S-adenosyl-L-methionine binding argues for a methyltransferase activity.
  • Tissue specificity
    Widely expressed. In adult, highly expressed in pancreas, placenta, fibroblast, thymus, prostate, testis, ovary and colon. Expressed at lower levels in spleen, small intestine and leukocytes. In fetus, expressed at high levels in the lung and kidney and at lower level in brain and liver.
  • Sequence similarities
    In the N-terminal section; belongs to the maf family.
  • Information by UniProt

Images

  • ab160116 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up