Recombinant Human Aspartate Aminotransferase protein (ab99147)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAPPSVFAEVPQAQPVLVFKLTADFREDPD PRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEF RSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNK NTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLEN APEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFA SGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPES ILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADR ILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHI YLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
    • Molecular weight
      48 kDa including tags
    • Amino acids
      1 to 413
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99147 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • AATC_HUMAN
    • Aspartate aminotransferase
    • Aspartate aminotransferase 1
    • Aspartate aminotransferase cytoplasmic
    • Aspartate aminotransferase cytosolic
    • ASTQTL1
    • cAspAT
    • cCAT
    • cysteine aminotransferase, cytoplasmic
    • cysteine transaminase, cytoplasmic
    • cytoplasmic
    • ec 2.6.1.1
    • GIG 18
    • GIG18
    • Glutamate oxaloacetate transaminase 1
    • Glutamate oxaloacetate transaminase soluble
    • Glutamic oxaloacetic transaminase 1 soluble
    • GOT 1
    • GOT1
    • Growth inhibiting protein 18
    • SGOT
    • Transaminase A
    see all
  • Function
    Plays a key role in amino acid metabolism.
  • Sequence similarities
    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99147.

References

ab99147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up