Recombinant Human Aspartate Aminotransferase protein (ab99147)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP17174
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAPPSVFAEVPQAQPVLVFKLTADFREDPD PRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEF RSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNK NTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLEN APEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFA SGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPES ILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADR ILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHI YLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
    • Molecular weight48 kDa including tags
    • Amino acids1 to 413
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99147 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • AATC_HUMAN
    • Aspartate aminotransferase
    • Aspartate aminotransferase 1
    • Aspartate aminotransferase cytoplasmic
    • Aspartate aminotransferase cytosolic
    • ASTQTL1
    • cAspAT
    • cCAT
    • cysteine aminotransferase, cytoplasmic
    • cysteine transaminase, cytoplasmic
    • cytoplasmic
    • ec 2.6.1.1
    • GIG 18
    • GIG18
    • Glutamate oxaloacetate transaminase 1
    • Glutamate oxaloacetate transaminase soluble
    • Glutamic oxaloacetic transaminase 1 soluble
    • GOT 1
    • GOT1
    • Growth inhibiting protein 18
    • SGOT
    • Transaminase A
    see all
  • FunctionPlays a key role in amino acid metabolism.
  • Sequence similaritiesBelongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Aspartate Aminotransferase protein images

  • 15% SDS-PAGE analysis of 3µg ab99147.

References for Recombinant Human Aspartate Aminotransferase protein (ab99147)

ab99147 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"