Recombinant Human ASRGL1 protein (ab164206)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLF HIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWA AAKDGKLHFG
    • Amino acids
      187 to 296
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALP
    • ALP1
    • ASGL1
    • Asparaginase like 1
    • Asparaginase like 1 protein
    • Asparaginase like protein 1
    • ASRGL 1
    • beta-aspartyl-peptidase
    • CRASH
    • FLJ22316
    • isoaspartyl dipeptidase
    • isoaspartyl peptidase/L-asparaginase
    • L asparaginase
    • L asparagine amidohydrolase
    see all
  • Relevance
    ASRGL1 acts in asparagine catabolism. It may be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions.
  • Cellular localization
    Cytoplasm. Note: Midpiece of sperm tail.

Images

  • ab164206 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up