Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVN TQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNK HHEIFNLL
    • Amino acids
      127 to 234
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALP1
    • ANKL1
    • Ankyrin like protein 1
    • Ankyrin repeat, SAM and basic leucine zipper domain containing protein 1
    • ASZ 1
    • C7orf7
    • GASZ
    • Germ cell specific ankyrin, SAM and basic leucine zipper domain containing protein
    • Orf3
    see all
  • Relevance
    ASZ1 contains six ANK repeats and one SAM (sterile alpha motif) domain. It may act as a cytoplasmic signal transducer that mediates protein-protein interactions during germ cell maturation in both males and females and also during preimplantive embryogenesis. ASZ1 is expressed exclusively in the testes and ovary and at higher levels in the adult testes compared with the adult ovary.
  • Cellular localization
    Cytoplasm

Images

  • ab165404 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up