Overview

  • Product name
    Recombinant Human ATAD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQP ALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLC VREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCL D
    • Amino acids
      1 to 151
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164682 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4921525H23Rik
    • AAA+ ATPase Thorase
    • Ab2-088
    • AFDC1
    • Atad1
    • ATAD1_HUMAN
    • ATPase family AAA domain containing protein 1
    • ATPase family AAA domain-containing protein 1
    • ATPase family, AAA domain containing 1
    • ATPase Thorase
    • AW107648
    • FLJ14600
    • FNP001
    • Thorase
    see all
  • Function
    ATPase that plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory. Required for NMDA-stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent.
  • Sequence similarities
    Belongs to the AAA ATPase family.
  • Cellular localization
    Peroxisome. Cell junction, synapse, postsynaptic cell membrane.
  • Information by UniProt

Images

  • ab164682 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164682 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164682.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up