Overview

  • Product name
    Recombinant Human ATCAY protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLN FNGAHRKRKTLVAPEI
    • Amino acids
      3 to 68
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ataxia Cayman type protein
    • Ataxia, cerebellar, Cayman type
    • Atcay
    • ATCAY_HUMAN
    • BNIP 2 homolgy
    • BNIP 2 homology
    • BNIP H
    • BNIP-H
    • Cayman ataxia
    • Caytaxin
    • CLAC
    see all
  • Involvement in disease
    Defects in ATCAY are the cause of cerebellar ataxia, cayman type (ATCAY) [MIM:601238]. ATCAY is found in a population isolate on Grand Cayman Island and causes a marked psychomotor retardation and prominent nonprogressive cerebellar dysfunction including nystagmus, intention tremor, dysarthria, and wide-based ataxic gait. Hypotonia is present from early childhood.
  • Sequence similarities
    Contains 1 CRAL-TRIO domain.
  • Domain
    The CRAL-TRIO domain is known to bind small hydrophobic molecules.
  • Information by UniProt

Images

  • ab164738 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up