Overview

  • Product name
    Recombinant Human ATE1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDL IDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPS
    • Amino acids
      1 to 87
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161295 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI225793
    • Arginine tRNA protein transferase 1
    • Arginine-tRNA--protein transferase 1
    • Arginyl-tRNA--protein transferase 1
    • Arginyl-tRNA-protein transferase
    • Arginyltransferase 1
    • Ate1
    • ATE1_HUMAN
    • AW547406
    • EC 2.3.2.8
    • MGC26724
    • OTTHUMP00000020637
    • OTTHUMP00000058665
    • R transferase 1
    • R-transferase 1
    see all
  • Function
    Involved in the post-translational conjugation of arginine to the N-terminal aspartate or glutamate of a protein. This arginylation is required for degradation of the protein via the ubiquitin pathway. Does not arginylate cysteine residues.
  • Sequence similarities
    Belongs to the R-transferase family.
  • Cellular localization
    Cytoplasm and Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab161295 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161295 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161295.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up