Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP18848
    • SpeciesHuman
    • SequenceMHHHHHHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQN PTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVF DKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFV QMMTAKGSHMTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVA KHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDL KEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPI GHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEG DRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGS PNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTA ATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEV RKARGKKRVP
    • Molecular weight57 kDa including tags
    • Amino acids1 to 351
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab109946 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Activating transcription factor 4
    • ATF 4
    • ATF4
    • ATF4 protein
    • ATF4_HUMAN
    • cAMP-dependent transcription factor ATF-4
    • cAMP-responsive element-binding protein 2
    • CREB 2
    • CREB-2
    • CREB2
    • Cyclic AMP dependent transcription factor ATF 4
    • Cyclic AMP response element binding protein 2
    • Cyclic AMP-dependent transcription factor ATF-4
    • Cyclic AMP-responsive element-binding protein 2
    • DNA binding protein TAXREB67
    • DNA-binding protein TAXREB67
    • Tax Responsive Enhancer Element B67
    • Tax-responsive enhancer element-binding protein 67
    • TaxREB67
    • TXREB
    see all
  • FunctionTranscriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. It binds to a Tax-responsive enhancer element in the long terminal repeat of HTLV-I.
  • Sequence similaritiesBelongs to the bZIP family.
    Contains 1 bZIP domain.
  • Cellular localizationCytoplasm. Cell membrane. Nucleus. Colocalizes with GABBR1 in hippocampal neuron dendritic membranes.
  • Information by UniProt

Recombinant Human ATF-4 protein images

  • 15% SDS-PAGE analysis of 3µg ab109946.

References for Recombinant Human ATF-4 protein (ab109946)

ab109946 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"