Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLS STPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSG ICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKM V AAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKK NE ALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
    • Amino acids
      123 to 351

Specifications

Our Abpromise guarantee covers the use of ab91898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 155 µl aqua dest.

General Info

  • Alternative names
    • Activating transcription factor 4
    • ATF 4
    • ATF4
    • ATF4 protein
    • ATF4_HUMAN
    • cAMP-dependent transcription factor ATF-4
    • cAMP-responsive element-binding protein 2
    • CREB 2
    • CREB-2
    • CREB2
    • Cyclic AMP dependent transcription factor ATF 4
    • Cyclic AMP response element binding protein 2
    • Cyclic AMP-dependent transcription factor ATF-4
    • Cyclic AMP-responsive element-binding protein 2
    • DNA binding protein TAXREB67
    • DNA-binding protein TAXREB67
    • Tax Responsive Enhancer Element B67
    • Tax-responsive enhancer element-binding protein 67
    • TaxREB67
    • TXREB
    see all
  • Function
    Transcriptional activator. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. It binds to a Tax-responsive enhancer element in the long terminal repeat of HTLV-I.
  • Sequence similarities
    Belongs to the bZIP family.
    Contains 1 bZIP domain.
  • Cellular localization
    Cytoplasm. Cell membrane. Nucleus. Colocalizes with GABBR1 in hippocampal neuron dendritic membranes.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

This product has been referenced in:
  • Martin S  et al. Cell-type variation in stress responses as a consequence of manipulating GRP78 expression in neuroectodermal cells. J Cell Biochem 116:438-49 (2015). Read more (PubMed: 25336069) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up