Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASLLKKELEQMEDFFLDAPLLPPPSPPPLPPPPLPPAPSLPLSLPSFDL PQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPY
    • Amino acids
      101 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activating transcription factor 5
    • Activating transcription factor 5 alpha/beta
    • Activating transcription factor X
    • AFTA
    • ATF 5
    • ATF 7
    • ATF7
    • ATFX
    • BZIP protein ATF7
    • cAMP dependent transcription factor ATF 5
    • cAMP dependent transcription factor ATF5
    • Cyclic AMP dependent transcription factor ATF 5
    • Cyclic AMP dependent transcription factor ATF5
    • FLJ34666
    • HMFN0395
    • MGC102397
    • NAP1
    • NRIF3 associated protein
    • ODA 10
    • Transcription factor ATFx
    • Transcription factor like protein ODA 10
    • Transcription factor like protein ODA10
    see all
  • Relevance
    ATF5 or Activating transcription factor 5, binds to cAMP inducible promoters and is involved in gene transcription. This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. ATF5 plays a role in inhibition of nerve growth factor induced neuronal outgrowth and regulation of neurogenesis.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab161433 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161433 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up