Recombinant Human ATG16L1 protein (ab153390)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVC TEQCVMSRHFDKKIRFWDIRSESIVREMELLGK
    • Amino acids
      459 to 541
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A16L1_HUMAN
    • APG16 like 1
    • APG16-like 1
    • APG16L
    • APG16L beta
    • ATG16 autophagy related 16 like 1
    • ATG16 autophagy related 16-like 1 (S. cerevisiae)
    • ATG16A
    • ATG16L
    • Atg16l1
    • Autophagy related protein 16 1
    • Autophagy-related protein 16-1
    • FLJ00045
    • FLJ10035
    • FLJ10828
    • FLJ22677
    • IBD10
    • OTTHUMP00000164391
    • OTTHUMP00000164393
    • OTTHUMP00000165876
    • OTTHUMP00000165877
    • WD repeat domain 30
    • WDR30
    see all
  • Function
    Plays an essential role in autophagy: interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C), to produce a membrane-bound activated form of LC3 named LC3-II. Thereby, controls the elongation of the nascent autophagosomal membrane.
  • Involvement in disease
    Inflammatory bowel disease 10
  • Sequence similarities
    Belongs to the WD repeat ATG16 family.
    Contains 7 WD repeats.
  • Post-translational
    modifications
    Proteolytic cleavage by activated CASP3 leads to degradation and may regulate autophagy upon cellular stress and apoptotic stimuli.
  • Cellular localization
    Cytoplasm. Preautophagosomal structure membrane. Recruited to omegasomes membranes by WIPI2. Omegasomes are endoplasmic reticulum connected strutures at the origin of preautophagosomal structures. Localized to preautophagosomal structure (PAS) where it is involved in the membrane targeting of ATG5. Localizes also to discrete punctae along the ciliary axoneme.
  • Information by UniProt

Images

  • ab153390 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up