Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVW ILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLR CGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQ MAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIE DIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLR LGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDP HTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDF DNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDS TEQLEEFDLEEDFEILSV
    • Molecular weight
      45 kDa
    • Amino acids
      1 to 398
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

General Info

  • Alternative names
    • AI627006
    • APG4 autophagy 4 homolog A
    • Apg4a
    • ATG4 autophagy related 4 homolog A
    • ATG4 autophagy related 4 homolog A (S. cerevisiae)
    • ATG4A
    • ATG4A_HUMAN
    • Atg4al
    • AUT like 2 cysteine endopeptidase
    • AUT-like 2 cysteine endopeptidase
    • Autl2
    • Autophagin 2
    • Autophagin-2
    • Autophagy related 4A cysteine peptidase
    • Autophagy related cysteine endopeptidase 2
    • Autophagy related protein 4 homolog A
    • Autophagy-related cysteine endopeptidase 2
    • Autophagy-related protein 4 homolog A
    • AV169859
    • Cysteine protease ATG4A
    • hAPG4A
    • MGC107179
    see all
  • Function
    Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. Preferred substrate is GABARAPL2 followed by MAP1LC3A and GABARAP.
  • Tissue specificity
    Widely expressed, at a low level, and the highest expression is observed in skeletal muscle and brain. Also detected in fetal liver.
  • Sequence similarities
    Belongs to the peptidase C54 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab172826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up