Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRL WFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQ RKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQ VLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSD RHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMP QSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFH CQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFE LVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 393

Specifications

Our Abpromise guarantee covers the use of ab188707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Typical enzyme concentration to support hydrolysis of substrates in vitro is 10- 100 nM depending on conditions. Pre-incubation (15 min) with 10 mM DTT is recommended to achieve maximum activity.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 1.19% HEPES, 0.58% Sodium chloride, 0.03% EDTA, 0.03% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • APG4 autophagy 4 homolog B
    • APG4B
    • ATG4 autophagy related 4 homolog B (S. cerevisiae)
    • ATG4B
    • ATG4B_HUMAN
    • AUT like 1 cysteine endopeptidase
    • AUT-like 1 cysteine endopeptidase
    • AUTL1
    • Autophagin 1
    • Autophagin-1
    • Autophagy related 4B cysteine peptidase
    • Autophagy related cysteine endopeptidase 1
    • Autophagy related protein 4 homolog B
    • Autophagy-related cysteine endopeptidase 1
    • Autophagy-related protein 4 homolog B
    • Cysteine protease ATG4B
    • hAPG4B
    • MGC1353
    see all
  • Function
    Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes.
  • Tissue specificity
    Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas.
  • Sequence similarities
    Belongs to the peptidase C54 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab188707 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up