Overview

  • Product name
    Recombinant Human ATIC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRD VSELTGFPEM LGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRV VACNLYPFVKTVASPGVTVEEA VEQIDIGGVTLLRAAAKNHARVTVVC EPEDYVVVSTEMQSSESKDTSLETRRQLALKAFT HTAQYDEAISDYFR KQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINL CD ALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDL YKTLTPIS AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDG IIAPGYEEEALTILSKKKNG NYCVLQMDQSYKPDENEVRTLFGLHLSQ KRNNGVVDKSLFSNVVTKNKDLPESALRDLIV ATIAVKYTQSNSVCYA KNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKT GVKR AEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEV SISSDA FFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIIL AHTNLRLFHH
    • Molecular weight
      91 kDa including tags
    • Amino acids
      1 to 592

Specifications

Our Abpromise guarantee covers the use of ab114743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AICAR formyltransferase/IMP cyclohydrolase
    • 5 aminoimidazole 4 carboxamide 1 beta D ribonucleotide transformylase/inosinicase
    • 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase
    • 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
    • 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase
    • AICAR
    • AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme
    • AICAR transformylase
    • AICARFT
    • AICARFT/IMPCHASE
    • ATIC
    • Bifunctional purine biosynthesis protein PURH
    • epididymis secretory sperm binding protein Li 70p
    • FLJ93545
    • HEL-S-70p
    • IMP cyclohydrolase
    • IMP synthase
    • IMP synthetase
    • IMPCHASE
    • Inosinicase
    • OK/SW-cl.86
    • Phosphoribosylaminoimidazolecarboxamide formyltransferase
    • Phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
    • PUR9_HUMAN
    • PURH
    see all
  • Function
    Bifunctional enzyme that catalyzes 2 steps in purine biosynthesis.
  • Pathway
    Purine metabolism; IMP biosynthesis via de novo pathway; 5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide from 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide (10-formyl THF route): step 1/1.
    Purine metabolism; IMP biosynthesis via de novo pathway; IMP from 5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide: step 1/1.
  • Involvement in disease
    Defects in ATIC are the cause of AICA-ribosuria [MIM:608688]; also known as AICA-ribosiduria. AICA-ribosuria is a neurologically devastating inborn error of purine biosynthesis. AICA-ribosuria patients excrete massive amounts of AICA-riboside in the urine and accumulate AICA-ribotide and its derivatives in erythrocytes and fibroblasts. AICA-ribosuria causes profound mental retardation, epilepsy, dysmorphic features and congenital blindness.
  • Sequence similarities
    Belongs to the purH family.
  • Domain
    The IMP cyclohydrolase activity resides in the N-terminal region.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114743 at approximately 91.19kDa.
    Stained with Coomassie Blue.

References

ab114743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up