Overview

  • Product nameRecombinant Human ATIC protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP31939
    • SpeciesHuman
    • SequenceMAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRD VSELTGFPEM LGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRV VACNLYPFVKTVASPGVTVEEA VEQIDIGGVTLLRAAAKNHARVTVVC EPEDYVVVSTEMQSSESKDTSLETRRQLALKAFT HTAQYDEAISDYFR KQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINL CD ALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDL YKTLTPIS AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDG IIAPGYEEEALTILSKKKNG NYCVLQMDQSYKPDENEVRTLFGLHLSQ KRNNGVVDKSLFSNVVTKNKDLPESALRDLIV ATIAVKYTQSNSVCYA KNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKT GVKR AEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEV SISSDA FFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIIL AHTNLRLFHH
    • Molecular weight91 kDa including tags
    • Amino acids1 to 592

Specifications

Our Abpromise guarantee covers the use of ab114743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AICAR formyltransferase/IMP cyclohydrolase
    • 5 aminoimidazole 4 carboxamide 1 beta D ribonucleotide transformylase/inosinicase
    • 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase
    • 5 aminoimidazole 4 carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
    • 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase
    • AICAR
    • AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme
    • AICAR transformylase
    • AICARFT
    • AICARFT/IMPCHASE
    • ATIC
    • Bifunctional purine biosynthesis protein PURH
    • epididymis secretory sperm binding protein Li 70p
    • FLJ93545
    • HEL-S-70p
    • IMP cyclohydrolase
    • IMP synthase
    • IMP synthetase
    • IMPCHASE
    • Inosinicase
    • OK/SW-cl.86
    • Phosphoribosylaminoimidazolecarboxamide formyltransferase
    • Phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
    • PUR9_HUMAN
    • PURH
    see all
  • FunctionBifunctional enzyme that catalyzes 2 steps in purine biosynthesis.
  • PathwayPurine metabolism; IMP biosynthesis via de novo pathway; 5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide from 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide (10-formyl THF route): step 1/1.
    Purine metabolism; IMP biosynthesis via de novo pathway; IMP from 5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide: step 1/1.
  • Involvement in diseaseDefects in ATIC are the cause of AICA-ribosuria [MIM:608688]; also known as AICA-ribosiduria. AICA-ribosuria is a neurologically devastating inborn error of purine biosynthesis. AICA-ribosuria patients excrete massive amounts of AICA-riboside in the urine and accumulate AICA-ribotide and its derivatives in erythrocytes and fibroblasts. AICA-ribosuria causes profound mental retardation, epilepsy, dysmorphic features and congenital blindness.
  • Sequence similaritiesBelongs to the purH family.
  • DomainThe IMP cyclohydrolase activity resides in the N-terminal region.
  • Information by UniProt

Recombinant Human ATIC protein images

  • 12.5% SDS-PAGE showing ab114743 at approximately 91.19kDa.
    Stained with Coomassie Blue.

References for Recombinant Human ATIC protein (ab114743)

ab114743 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"