Overview

  • Product name
    Recombinant Human ATOX1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVK YDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
    • Molecular weight
      10 kDa including tags
    • Amino acids
      1 to 68
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116474 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab116474 is purified by proprietary chromatographic techniques and filter sterilized.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names
    • ATOX1
    • ATOX1_HUMAN
    • ATX1
    • ATX1 antioxidant protein 1 homolog
    • ATX1 antioxidant protein 1 homolog (yeast)
    • Copper transport protein
    • Copper transport protein ATOX1
    • HAH1
    • Metal transport protein
    • Metal transport protein ATX1
    • MGC138453
    • MGC138455
    see all
  • Function
    Could bind and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the ATX1 family.
    Contains 1 HMA domain.
  • Information by UniProt

References for Recombinant Human ATOX1 protein (ab116474)

ab116474 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116474.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up