Recombinant Human ATP1B3 protein (ab157927)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFL AALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDP TSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISL LQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPN VAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVEC KIDGSANLKSQDDRDKFLGRVMFKITARA
    • Amino acids
      1 to 279
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AT1B3_HUMAN
    • atp1b3
    • ATPase Na+/K+ transporting beta 3 polypeptide
    • ATPB 3
    • ATPB-3
    • ATPB3
    • CD 298
    • CD298
    • CD298 antigen
    • FLJ29027
    • Na K ATPase beta 3 polypeptide
    • Na+/K+ ATPase beta 3 subunit
    • NKAB3S
    • Sodium potassium ATPase subunit beta 3 (non catalytic)
    • Sodium pump subunit beta 3
    • Sodium/potassium dependent ATPase beta 3 subunit
    • Sodium/potassium dependent ATPase subunit beta 3
    • Sodium/potassium transporting ATPase beta 3 chain
    • Sodium/potassium transporting ATPase subunit beta 3
    • Sodium/potassium-dependent ATPase subunit beta-3
    • Sodium/potassium-transporting ATPase subunit beta-3
    see all
  • Function
    This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-3 subunit is not known.
  • Sequence similarities
    Belongs to the X(+)/potassium ATPases subunit beta family.
  • Cellular localization
    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • ab157927 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up