Overview

  • Product name
    Recombinant Human ATP5A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAE MSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS GLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRV VDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLV PIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIG QKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE RAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELF YKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFG SDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLE PSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAG FEA
    • Amino acids
      1 to 553
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP synthase alpha chain, mitochondrial
    • ATP synthase subunit alpha
    • ATP synthase subunit alpha mitochondrial
    • ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle
    • ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, 1
    • ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1, cardiac muscle
    • ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 2, non-cardiac muscle-like 2
    • ATP sythase (F1 ATPase) alpha subunit
    • ATP5A
    • Atp5a1
    • ATP5AL2
    • ATPA_HUMAN
    • ATPM
    • Epididymis secretory sperm binding protein Li 123m
    • hATP1
    • HEL-S-123m
    • MC5DN4
    • mitochondrial
    • Mitochondrial ATP synthetase
    • Mitochondrial ATP synthetase oligomycin resistant
    • Modifier of Min 2 mouse homolog
    • Modifier of Min 2, mouse, homolog of
    • MOM2
    • OMR
    • ORM
    • OTTHUMP00000163475
    see all
  • Function
    Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Subunit alpha does not bear the catalytic high-affinity ATP-binding sites.
  • Tissue specificity
    Fetal lung, heart, liver, gut and kidney. Expressed at higher levels in the fetal brain, retina and spinal cord.
  • Sequence similarities
    Belongs to the ATPase alpha/beta chains family.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Mitochondrion inner membrane. Peripheral membrane protein.
  • Information by UniProt

Images

  • ab157931 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up