Recombinant Human ATP5F1 protein (ab152212)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKE VKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIAD
    • Molecular weight
      37 kDa including tags
    • Amino acids
      143 to 242

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AT5F1_HUMAN
    • ATP synthase B chain mitochondrial
    • ATP synthase subunit b
    • ATP synthase subunit b mitochondrial
    • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b,
    • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1
    • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
    • ATP5F1
    • ATPase subunit b
    • Cell proliferation inducing protein 47
    • H+ ATP synthase subunit b
    • MGC24431
    • mitochondrial
    • PIG47
    see all
  • Function
    Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.
  • Sequence similarities
    Belongs to the eukaryotic ATPase B chain family.
  • Cellular localization
    Mitochondrion. Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152212 stained with Coomassie Blue.

References

ab152212 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up