Overview

  • Product name
    Recombinant Human ATP5I protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKK QDELKRIARELAEDDSILK
    • Amino acids
      1 to 69
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP 5I
    • ATP 5K
    • ATP synthase e chain mitochondrial
    • ATP synthase H+ transporting mitochondrial F0 complex subunit E
    • ATP synthase subunit e
    • ATP synthase subunit e mitochondrial
    • ATP5I
    • ATP5I_HUMAN
    • ATP5K
    • ATPase subunit e
    • F1F0 ATP synthase murine e subunit
    • MGC12532
    • mitochondrial
    see all
  • Function
    Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.
  • Sequence similarities
    Belongs to the ATPase e subunit family.
  • Cellular localization
    Mitochondrion. Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab157938 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up