Recombinant Human ATP6V0D2 protein (ab166007)

Overview

  • Product name
    Recombinant Human ATP6V0D2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGK TLEDVFYEREVQMNVLAFN
    • Amino acids
      238 to 306
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP6D2
    • ATPase H+ transporting lysosomal 38kDa V0 subunit D
    • ATPase H+ transporting lysosomal 38kDa V0 subunit D isoform 2
    • ATPase H+ transporting lysosomal 38kDa V0 subunit D2
    • FLJ38708
    • V ATPase subunit d 2
    • Vacuolar ATP synthase subunit d 2
    • Vacuolar proton pump subunit d 2
    • VMA 6
    • VMA6
    see all
  • Relevance
    Vacuolar ATPase (V ATPase) is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (components: a, c, c', c'' and d). It is responsible for acidifying a variety of intracellular organelles in eukaryotic cells. ATP6V0D2 is a component of the integral membrane V0 complex of vacuolar ATPase and may have a role in coupling of proton transport and ATP hydrolysis. ATP6V0D2 may be involved in regulation of osteoclast fusion and bone formation.
  • Cellular localization
    Apical plasma membrane

Images

  • ab166007 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up