Recombinant Human ATP6V1A protein (ab114780)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP38606
    • SpeciesHuman
    • SequenceTLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVET TAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLED MQNAFRSLED
    • Molecular weight38 kDa including tags
    • Amino acids508 to 617

Specifications

Our Abpromise guarantee covers the use of ab114780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 70kDa subunit
    • ATP6A1
    • ATP6V1A
    • ATP6V1A1
    • ATPase H+ transporting lysosomal subunit A1
    • ATPase H+ transporting, lysosomal 70kDa V1 subunit A
    • H(+) transporting two sector ATPase subunit A
    • H+ transporting ATPase chain A vacuolar (VA68 type)
    • HO68
    • OTTHUMP00000214746
    • V ATPase 69 kDa subunit 1
    • V ATPase A subunit 1
    • V ATPase subunit A 1
    • V-ATPase 69 kDa subunit
    • V-ATPase subunit A
    • V-type proton ATPase catalytic subunit A
    • VA68
    • Vacuolar ATP synthase catalytic subunit A ubiquitous isoform
    • Vacuolar ATPase isoform VA68
    • Vacuolar proton pump alpha subunit 1
    • Vacuolar proton pump subunit alpha
    • VATA_HUMAN
    • Vma1
    • VPP2
    see all
  • FunctionCatalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
  • Tissue specificityPresent in all tissues analyzed.
  • Sequence similaritiesBelongs to the ATPase alpha/beta chains family.
  • Information by UniProt

Recombinant Human ATP6V1A protein images

  • ab114780 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human ATP6V1A protein (ab114780)

ab114780 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"