Recombinant Human ATP6V1C1 protein (ab116917)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP21283
    • SpeciesHuman
    • SequenceMTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDV LVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVT YITRFQWDMA
    • Molecular weight38 kDa including tags
    • Amino acids1 to 110

Specifications

Our Abpromise guarantee covers the use of ab116917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP6C
    • ATP6D
    • ATP6V1C1
    • ATPase H+ transporting lysosomal (vacuolar proton pump) 42kD
    • ATPase H+ transporting lysosomal 42kD V1 subunit C isoform 1
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C isoform 1
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C1
    • ATPase H+ transporting lysosomal V1 subunit C1
    • FLJ20057
    • H(+) transporting two sector ATPase subunit C
    • H+ ATPase C subunit
    • H+ transporting ATPase chain C vacuolar
    • Subunit C of vacuolar proton ATPase V1 domain
    • V ATPase C subunit
    • V ATPase subunit C 1
    • V-ATPase subunit C 1
    • V-type proton ATPase subunit C 1
    • Vacuolar ATP synthase subunit C
    • Vacuolar proton pump 42 kD subunit
    • Vacuolar proton pump C subunit
    • Vacuolar proton pump subunit C 1
    • Vacuolar protonATPase subunit C VI domain
    • VATC
    • VATC1_HUMAN
    • VATPase C subunit
    • VATPase subunit C 1
    • VMA5
    see all
  • FunctionSubunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the V-ATPase C subunit family.
  • Information by UniProt

Recombinant Human ATP6V1C1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116917 at approximately 37.73 kDa.

References for Recombinant Human ATP6V1C1 protein (ab116917)

ab116917 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"