Recombinant Human ATP6V1C1 protein (ab116917)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDV LVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVT YITRFQWDMA
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 110

Specifications

Our Abpromise guarantee covers the use of ab116917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP6C
    • ATP6D
    • ATP6V1C1
    • ATPase H+ transporting lysosomal (vacuolar proton pump) 42kD
    • ATPase H+ transporting lysosomal 42kD V1 subunit C isoform 1
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C isoform 1
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C1
    • ATPase H+ transporting lysosomal V1 subunit C1
    • FLJ20057
    • H(+) transporting two sector ATPase subunit C
    • H+ ATPase C subunit
    • H+ transporting ATPase chain C vacuolar
    • Subunit C of vacuolar proton ATPase V1 domain
    • V ATPase C subunit
    • V ATPase subunit C 1
    • V-ATPase subunit C 1
    • V-type proton ATPase subunit C 1
    • Vacuolar ATP synthase subunit C
    • Vacuolar proton pump 42 kD subunit
    • Vacuolar proton pump C subunit
    • Vacuolar proton pump subunit C 1
    • Vacuolar protonATPase subunit C VI domain
    • VATC
    • VATC1_HUMAN
    • VATPase C subunit
    • VATPase subunit C 1
    • VMA5
    see all
  • Function
    Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the V-ATPase C subunit family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116917 at approximately 37.73 kDa.

References

ab116917 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up