Recombinant Human ATPAF1 protein (ab163868)

Overview

  • Product name
    Recombinant Human ATPAF1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAE AQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAE LKCAQNQNKT
    • Amino acids
      219 to 328
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP synthase mitochondrial F1 complex assembly factor 1
    • ATP11
    • ATP11 homolog
    • ATP11p
    • ATPAF 1
    • atpaf1
    • ATPF1_HUMAN
    • FLJ22351
    • Homolog of yeast ATP11
    • MGC88060
    see all
  • Function
    May play an essential role for the assembly of the mitochondrial F1-F0 complex.
  • Tissue specificity
    Weakly expressed in muscle.
  • Sequence similarities
    Belongs to the ATP11 family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab163868 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up