Overview

  • Product name
    Recombinant Human ATX2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PQNSFPAAQQTVFTIHPSHVQPAYTNPPHMAHVPQAHVQSGMVPSHPTAH APMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL
    • Amino acids
      1214 to 1313
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ASL13
    • Ataxin 2
    • Ataxin-2
    • ATX2_HUMAN
    • Atxn2
    • Olivopontocerebellar ataxia 2, autosomal dominant
    • SCA2
    • Spinocerebellar ataxia type 2 protein
    • TNRC13
    • Trinucleotide repeat containing 13
    • Trinucleotide repeat containing gene 13 protein
    • Trinucleotide repeat-containing gene 13 protein
    see all
  • Function
    Involved in EGFR trafficking, acting as negative regulator of endocytic EGFR internalization at the plasma membrane.
  • Tissue specificity
    Expressed in the brain, heart, liver, skeletal muscle, pancreas and placenta. Isoform 1 is predominant in the brain and spinal cord. Isoform 4 is more abundant in the cerebellum. In the brain, broadly expressed in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus.
  • Involvement in disease
    Spinocerebellar ataxia 2
    Amyotrophic lateral sclerosis 13
  • Sequence similarities
    Belongs to the ataxin-2 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab159476 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up