Overview

  • Product name
    Recombinant Human AUH protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSSEMKTEDELRVRHLEEENRGIVVLGINR AYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKER AKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDI RVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGK EAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQG MEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE
    • Molecular weight
      31 kDa including tags
    • Amino acids
      68 to 339
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101821 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 3 methylglutaconyl CoA hydratase
    • AU binding protein/enoyl CoA hydratase
    • AU RNA binding protein/enoyl CoA hydratase
    • AU RNA binding protein/enoyl Coenzyme A hydratase
    • AU specific RNA binding
    • AU specific RNA binding enoyl CoA hydratase
    • Methylglutaconyl CoA hydratase
    • Methylglutaconyl CoA hydratase mitochondrial
    • MGA Type I
    see all
  • Relevance
    AUH (3-methylglutaconyl-CoA hydratase) catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA and has very low enoyl-CoA hydratase activity. Deletion or mutation of the AUH gene causes the metabolic disease 3-methylglutaconic aciduria type I (MGA1). MGA type I is characterized by an abnormal organic acid profile in which there is excessive urinary excretion of 3-methylglutaconic acid, 3-methylglutaric acid and 3-hydroxyisovaleric acid. AUH is also an RNA-binding protein that binds in vitro to clustered 5'-AUUUA-3' motifs.
  • Cellular localization
    Mitochondrial

Recombinant Human AUH protein images

  • 15% SDS-PAGE analysis of 3µg ab101821.

References for Recombinant Human AUH protein (ab101821)

ab101821 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up