Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNG FRQMNLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQ IDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYVRSGGENTAYMSNG G LGSLKVVCGYLPTLNEEEEWTCADFKCKLSPTVVGLSSKTLRATASV RS TETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDSEISSDALTD DSM SMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHR LPKE MTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEERE GSELT LNSREGAPTQHPLS
    • Amino acids68 to 424

Specifications

Our Abpromise guarantee covers the use of ab92262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 67 µl aqua dest.

General Info

  • Alternative names
    • Axil
    • Axin like protein
    • Axin-2
    • Axin-like protein
    • Axin2
    • AXIN2_HUMAN
    • Axis inhibition protein 2
    • Conductin
    • DKFZp781B0869
    • MGC10366
    • MGC126582
    see all
  • FunctionInhibitor of the Wnt signaling pathway. Down-regulates beta-catenin. Probably facilitate the phosphorylation of beta-catenin and APC by GSK3B.
  • Tissue specificityExpressed in brain and lymphoblast.
  • Involvement in diseaseDefects in AXIN2 are involved in colorectal cancer (CRC) [MIM:114500]. They appear to be specifically associated with defective mismatch repair.
    Defects in AXIN2 are the cause of oligodontia-colorectal cancer syndrome (ODCRCS) [MIM:608615]. Affected individuals manifest severe tooth agenesis and colorectal cancer or precancerous lesions of variable types.
  • Sequence similaritiesContains 1 DIX domain.
    Contains 1 RGS domain.
  • DomainThe tankyrase-binding motif (also named TBD) is required for interaction with tankyrase TNKS and TNKS2.
  • Post-translational
    modifications
    Probably phosphorylated by GSK3B and dephosphorylated by PP2A.
    ADP-ribosylated by tankyrase TNKS and TNKS2. Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination and subsequent activation of the Wnt signaling pathway.
    Ubiquitinated by RNF146 when poly-ADP-ribosylated, leading to its degradation and subsequent activation of the Wnt signaling pathway. Deubiquitinated by USP34, deubiquitinated downstream of beta-catenin stabilization step: deubiquitination is important Wnt signaling to positively regulate beta-catenin (CTNBB1)-mediated transcription.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Axin 2 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human Axin 2 protein (ab92262)

ab92262 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"