Recombinant Human Axotrophin protein (ab163891)

Overview

  • Product name
    Recombinant Human Axotrophin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WYSESEITQGARSRSQNQQRDHDSKRPKLSCTNCTTSAGRNVGNGLNTLS DSSWRHSQVPRSSSMVLGSFG
    • Amino acids
      66 to 136
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AXO
    • AXOT
    • Axotrophin
    • E3 ubiquitin-protein ligase MARCH7
    • MARCH VII
    • MARCH-VII
    • March7
    • MARH7_HUMAN
    • Membrane associated RING CH protein VII
    • Membrane associated ring finger (C3HC4) 7 E3 ubiquitin protein ligase
    • membrane associated ring finger C3HC4 7
    • Membrane associated RING finger protein 7
    • Membrane-associated RING finger protein 7
    • Membrane-associated RING-CH protein VII
    • RING finger protein 177
    • RNF177
    see all
  • Function
    E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-CH-type zinc finger.
  • Domain
    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Information by UniProt

Images

  • ab163891 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up