Overview

  • Product name
    Recombinant Human AXUD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTGLLKRKFDQLDEDNSSVSSSSSSSGCQSRSCSPSSSVSRAWDSEEEGP WDQMPLPDRDFCGPRSFTPLSILKRARRERPGRVAFDGITVFYFPRCQGF TSVPSRGGCTLGMALRHSACRRFSLAEFAQEQARARHEKLRQRLKEEKLE MLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVSFLQ PYPARRRRALLRASGVRRIDREEKRELQALRQSREDCGCHCDRICDPETC SCSLAGIKCQMDHTAFPCGCCREGCENPMGRVEFNQARVQTHFIHTLTRL QLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAKPPMNNELGDNSCSS DMTDSSTASSSASGTSEAPDCPTHPGLPGPGFQPGVDDDSLARILSFSDS DFGGEEEEEEEGSVGNLDNLSCFHPADIFGTSDPGGLASWTHSYSGCSFT SGILDENANLDASCFLNGGLEGSREGSLPGTSVPPSMDAGRSSSVDLSLS SCDSFELLQALPDYSLGPHYTSQKVSDSLDNIEAPHFPLPGLSPPGDASS CFLESLMGFSEPAAEALDPFIDSQFEDTVPASLMEPVPV
    • Amino acids
      1 to 589
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4931429D10Rik
    • Axin 1 Up-regulated
    • Axin-1 up-regulated gene 1 protein
    • CSRN1_HUMAN
    • CSRNP-1
    • CSRNP1
    • Cysteine/serine-rich nuclear protein 1
    • DKFZp566F164
    • FAM130B
    • Protein URAX1
    • TAIP 3
    • TAIP-3
    • TGF beta induced apoptosis protein 3
    • TGF-beta-induced apoptosis protein 3
    • URAX1
    see all
  • Function
    Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity (By similarity). May have a tumor-suppressor function. May play a role in apoptosis.
  • Tissue specificity
    Ubiquitous. Most abundantly expressed in lung, placenta, skeletal muscle, pancreas and leukocyte. Frequently down-regulated in lung, kidney, liver and colon cancers compared with their corresponding normal tissues.
  • Sequence similarities
    Belongs to the AXUD1 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163854 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up