Overview

  • Product name
    Recombinant Human AZI2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKK RLKDSEKENSLLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVC IDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRN LNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQ EDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTS TAIKKACAPVGCSEDLGRDSTKLHLMNFTATYTRHPPLLPNGKALCHTTS SPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWV FPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN
    • Amino acids
      1 to 392
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 azacytidine induced protein 2
    • 5-azacytidine-induced protein 2
    • AA410145
    • AZ2
    • AZI2
    • AZI2_HUMAN
    • MGC112644
    • Nak associated protein 1
    • Nak-associated protein 1
    • NAP1
    • NF kappa B activating kinase associated protein 1
    • NF-kappa-B-activating kinase-associated protein 1
    • TILP
    • TILP(S)
    see all
  • Function
    Activates serine/threonine-protein kinase TBK1 and facilitates its oligomerization. Enhances the phosphorylation of NF-kappa-B p65 subunit RELA by TBK1. Promotes TBK1-induced as well as TNF-alpha or PMA-induced activation of NF-kappa-B. Participates in IFN-beta promoter activation via TICAM1.
  • Tissue specificity
    Widely expressed. Abundant expression seen in the pancreas and testis.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163822 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up