Recombinant Human B3GALNT2 protein (ab165582)

Overview

  • Product name
    Recombinant Human B3GALNT2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRNWLVLLCPCVLGAALHLWLRLRSPPPACASGAGPADQLALFPQWKSTH YDVVVGVLSARNNHELRNVIRSTWMRHLLQHPTLSQRVLVKFIIGAHGCE VPVEDREDPYSCKLLNITNPVLNQEIEAFSLSEDTSSGLPEDRVVSVSFR VLYPIVITSLGVFYDANDVGFQRNITVKLYQAEQEEALFIARFSPPSCGV QVNKLWYKPVEQFILPESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVL RVITAGEGALPHEFLEGVEGVAGGFIYTIQEGDALLHNLHSRPQRLIDHI RNLHEEDALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFN LLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQEL EYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDVSMGIWMAAI GPKRYQDSLWLCEKTCETGMLSSPQYSPWELTELWKLKERCGDPCRCQAR
    • Amino acids
      1 to 500
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-GalNAc-T2
    • 3-N-acetylgalactosaminyltransferase 2
    • 3-N-acetylgalactosaminyltransferase II
    • B3GalNAc T2
    • B3GalNAcT2
    • b3galnt2
    • B3GL2_HUMAN
    • Beta 1,3 galactosaminyltransferase 2
    • Beta 1,3 N acetylgalactosaminyltransferase 2
    • Beta 1,3 N acetylgalactosaminyltransferase II
    • Beta 1,3 N acetylgalactosaminyltransferase II MGC39558
    • Beta 3 GalNAc T2
    • Beta-1
    • beta-1,3-GalNAc-T2
    • Beta3GalNAcT2
    • MDDGA11
    • MGC39558
    • UDP GalNAc:betaGlcNAc beta 1,3 galactosaminyltransferase polypeptide 2
    • UDP-GalNAc:beta-1
    • UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2
    see all
  • Function
    Beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. Has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.
  • Tissue specificity
    Expressed in all tissues examined, but at highest levels in testis, adipose tissue, skeletal muscle and ovary.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 31 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab165582 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up