Recombinant Human B3GALT1 protein (ab160153)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTF GNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRET WGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYH NLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRR RYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAEL IYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV ITVHQISPEEMHRIWNDMSSKKHLRC
    • Amino acids
      1 to 326
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-galactosyltransferase 1
    • 3-GalTase 1
    • B3GALT1
    • B3GT1_HUMAN
    • Beta 1,3 galactosyltransferase 1
    • Beta 1,3 GalTase 1
    • Beta 3 galt1
    • Beta-1
    • beta3Gal T1
    • Beta3Gal-T1
    • Beta3GalT1
    • UDP Gal:betaGlcNAc beta 1,3 galactosyltransferase, polypeptide 1
    • UDP galactose:beta N acetyl glucosamine beta 1,3 galactosyltransferase 1
    • UDP-galactose:beta-N-acetyl-glucosamine-beta-1
    see all
  • Function
    Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins. Inactive towards substrates with terminal alpha-N-acetylglucosamine (alpha-GlcNAc) or alpha-N-acetylgalactosamine (alpha-GalNAc) residues.
  • Tissue specificity
    Detected in brain and colon mucosa and to a lesser extent in colon adenocarcinoma cells.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 31 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160153 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up