Recombinant Human B3GALT4 protein (ab160149)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TLKTLSGLNWAEKHCPMARYVLKTDDDVYVNVPELVSELVLRGGRWGQWE RSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNPSRTPGGRHRVSEEQ
    • Amino acids
      151 to 250
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-galactosyltransferase
    • 3-galactosyltransferase 4
    • 3-GalTase 4
    • b3Gal-T4
    • B3GALT4
    • B3GT4_HUMAN
    • Beta 1,3 galactosyltransferase 4
    • Beta 1,3 GalTase 4
    • Beta 3 galactosyltransferase 4
    • Beta-1
    • Beta3Gal-T4
    • Beta3GalT4
    • Gal T2
    • GAL-T2
    • GALT2
    • GalT4
    • Ganglioside galactosyltransferase
    • OTTHUMP00000029128
    • UDP Gal:betaGlcNAc beta 1,3 galactosyltransferase, polypeptide 4
    • UDP galactose:beta N acetyl galactosamine beta 1,3 galactosyltransferase
    • UDP-galactose:beta-N-acetyl-galactosamine-beta-1
    see all
  • Function
    Involved in GM1/GD1B/GA1 ganglioside biosynthesis.
  • Tissue specificity
    Highly expressed in heart, skeletal muscle and pancreas and, to a lesser extent, in brain, placenta, kidney, liver and lung.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 31 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160149 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up