Recombinant Human B3GALT6 protein (ab165262)

Overview

  • Product name
    Recombinant Human B3GALT6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVT HKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGI P
    • Amino acids
      229 to 329
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta 1 3 galactosyltransferase 6
    • Beta 3GalT6
    • Beta3GalT6
    • GAG GalTII
    • Galactosyltransferase II
    • Galactosylxylosylprotein 3 beta galactosyltransferase
    • UDP Gal:betaGal beta 1 3 galactosyltransferase polypeptide 6
    • UDP Gal:betaGlcNAc beta 1 3 galactosyltransferase polypeptide 6
    see all
  • Relevance
    B3GALT6 is a beta-1,3-galactosyltransferase which belongs to the glycosyltransferase 31 family. It transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has no activity towards substrates with terminal galactosamine or glucosamine residues.
  • Cellular localization
    Golgi apparatus. Golgi stack membrane; Single pass type II membrane protein.

Images

  • ab165262 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up