Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEV LNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC
    • Amino acids
      316 to 415
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-N-acetylglucosaminyltransferase
    • 3-N-acetylglucosaminyltransferase 1
    • B3GN-T1
    • B3GN1_HUMAN
    • B3GNT1
    • B3GNT6
    • beta-1,3-N-acetylglucosaminyltransferase bGnT-6
    • BETA3GNTI
    • I-beta-1
    • i-beta-1,3-N-acetylglucosaminyltransferase
    • iGAT
    • iGnT
    • N-acetyllactosaminide beta-1
    • N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase
    • OTTHUMP00000235058
    • Poly-N-acetyllactosamine extension enzyme
    • UDP-GlcNAc:betaGal beta-1
    • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1
    • UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6
    see all
  • Function
    Can initiate the synthesis or the elongation of the linear poly-N-acetyllactosaminoglycans.
  • Tissue specificity
    In the adult, highly expressed in heart, brain, skeletal muscle and kidney and to a lesser extent in placenta, pancreas, spleen, prostate, testis, ovary, small intestine and colon. Very weak expression in lung, liver, thymus and peripheral blood leukocytes. In fetal highly expressed in brain and kidney and to a lesser extent in lung and liver.
  • Pathway
    Protein modification; protein glycosylation.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161262 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up