Recombinant Human B3GNT1 protein (ab161107)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWK ISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDL RVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKS LTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKF ESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFV NTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLY PPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKH KGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC
    • Amino acids
      1 to 397
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-galactosyltransferase 7
    • 3-GalTase 7
    • 3-Gn-T1
    • 3-Gn-T2
    • 3-N-acetylglucosaminyltransferase 1
    • 3-N-acetylglucosaminyltransferase 2
    • b3Gal-T7
    • B3GN2_HUMAN
    • B3GNT
    • B3GNT2
    • Beta 1 3 galactosyltransferase 7
    • Beta-1
    • Beta-3-Gx-T7
    • Beta3Gal-T7
    • Beta3GalT7
    • Beta3Gn T1
    • Beta3Gn-T1
    • Beta3Gn-T2
    • Beta3GNT
    • BGnT-1
    • BGnT-2
    • UDP-Gal:beta-GlcNAc beta-1
    • UDP-galactose:beta-N-acetylglucosamine beta-1
    • UDP-GlcNAc:betaGal beta-1
    see all
  • Function
    Catalyzes the initiation and elongation of poly-N-acetyllactosamine chains.
  • Tissue specificity
    Ubiquitous.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 31 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161107 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up