Recombinant Human B3GNT4 protein (ab164023)

Overview

  • Product name
    Recombinant Human B3GNT4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGYVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAGFKTF GIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGPIPQR
    • Amino acids
      279 to 378
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B3GN T4
    • Beta 1,3 Gn T4
    • Beta 1,3 N acetylglucosaminyltransferase 4
    • Beta 1,3 N acetylglucosaminyltransferase bGn T4
    • Beta3Gn T4
    • BGnT4
    • EC 2.4.1.-
    • UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 4
    see all
  • Relevance
    B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate.
  • Cellular localization
    Golgi Apparatus membrane; Single-pass type II membrane protein

Images

  • ab164023 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up