Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLG LVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTY KCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPT VVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIE NDIAKATGDIKVTESEIKRRSHLQLLNSKA
    • Molecular weight
      26 kDa including tags
    • Amino acids
      29 to 258
    • Tags
      His tag C-Terminus
    • Additional sequence information
      NP_078902.

Specifications

Our Abpromise guarantee covers the use of ab191634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to inhibit anti-CD3 antibody induced IL2 secretion in Human T lymphocytes.
    The ED50 for this effect is typically 0.75 - 3 µg/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.4
    Constituents: 5% Trehalose, 95% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • B7 family member, H4
    • B7 H4
    • B7 homolog 4
    • B7 superfamily member 1
    • B7 superfamily, member 1
    • B7-H4
    • B7h.5
    • B7h4
    • B7S1
    • B7x
    • BC032925
    • Immune costimulatory protein B7-H4
    • Immune costimulatory protein B7H4
    • MGC41287
    • PRO1291
    • Protein B7S1
    • RP11 229A19.4
    • T cell costimulatory molecule B7x
    • T-cell costimulatory molecule B7x
    • V set domain-containing T cell activation inhibitor 1
    • V-set domain-containing T-cell activation inhibitor 1
    • VCTN1
    • Vtcn1
    • VTCN1_HUMAN
    see all
  • Function
    Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.
  • Tissue specificity
    Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane. Expressed at the cell surface. A soluble form has also been detected.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab191634 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 45-60 kDa due to glycosylation.

References

ab191634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up