Overview

  • Product nameRecombinant Human b9HSP protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BQS6
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMQRVGNTFSNESRVASRCPSVGLAERNRVA TMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVT GQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQ CVALALPEAQTGPSPRLGSLGSKASNLTR
    • Molecular weight20 kDa including tags
    • Amino acids1 to 159
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab124569 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • Cancer/testis antigen 51
    • CT51
    • Heat shock protein alpha crystallin related B9
    • Heat shock protein beta 9
    • Heat shock protein beta-9
    • HspB9
    • HSPB9_HUMAN
    • Small heat shock protein B9
    see all
  • Tissue specificityTestis specific.
  • Sequence similaritiesBelongs to the small heat shock protein (HSP20) family.
  • Cellular localizationCytoplasm. Nucleus. Translocates to nuclear foci during heat shock.
  • Information by UniProt

Recombinant Human b9HSP protein images

  • 15% SDS-PAGE analysis of 3 µg ab124569.

References for Recombinant Human b9HSP protein (ab124569)

ab124569 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"