Overview

  • Product name
    Recombinant Human b9HSP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMQRVGNTFSNESRVASRCPSVGLAERNRVA TMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVT GQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQ CVALALPEAQTGPSPRLGSLGSKASNLTR
    • Molecular weight
      20 kDa including tags
    • Amino acids
      1 to 159
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab124569 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • Cancer/testis antigen 51
    • CT51
    • Heat shock protein alpha crystallin related B9
    • Heat shock protein beta 9
    • Heat shock protein beta-9
    • HspB9
    • HSPB9_HUMAN
    • Small heat shock protein B9
    see all
  • Tissue specificity
    Testis specific.
  • Sequence similarities
    Belongs to the small heat shock protein (HSP20) family.
  • Cellular localization
    Cytoplasm. Nucleus. Translocates to nuclear foci during heat shock.
  • Information by UniProt

Recombinant Human b9HSP protein images

  • 15% SDS-PAGE analysis of 3 µg ab124569.

References for Recombinant Human b9HSP protein (ab124569)

ab124569 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up