Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKS GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY RDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFI NGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFP LNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEING QDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDG FWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVE DVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACH VHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFML PLCLMVCQWRCLRCLRQQHDDFADDISLLK
    • Amino acids
      22 to 501
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APP beta secretase
    • Asp 2
    • ASP2
    • Aspartyl protease 2
    • BACE
    • BACE 1
    • BACE1
    • BACE1_HUMAN
    • Beta secretase
    • Beta secretase 1
    • Beta site amyloid beta A4 precursor protein cleaving enzyme
    • Beta site amyloid precursor protein cleaving enzyme
    • Beta site amyloid precursor protein cleaving enzyme 1
    • Beta site APP cleaving enzyme
    • Beta site APP cleaving enzyme 1
    • Beta-secretase 1
    • Beta-site amyloid precursor protein cleaving enzyme 1
    • Beta-site APP cleaving enzyme 1
    • FLJ90568
    • HSPC104
    • Memapsin 2
    • Memapsin-2
    • Memapsin2
    • Membrane associated aspartic protease 2
    • Membrane-associated aspartic protease 2
    • Transmembrane aspartic proteinase Asp2
    see all
  • Function
    Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cleaves at the N-terminus of the A-beta peptide sequence, between residues 671 and 672 of APP, leads to the generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated C-terminal fragment which is later released by gamma-secretase.
  • Tissue specificity
    Expressed at high levels in the brain and pancreas. In the brain, expression is highest in the substantia nigra, locus coruleus and medulla oblongata.
  • Sequence similarities
    Belongs to the peptidase A1 family.
  • Domain
    The transmembrane domain is necessary for its activity. It determines its late Golgi localization and access to its substrate, APP.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane. Golgi apparatus > trans-Golgi network. Endoplasmic reticulum. Endosome. Cell surface. Predominantly localized to the later Golgi/trans-Golgi network (TGN) and minimally detectable in the early Golgi compartments. A small portion is also found in the endoplasmic reticulum, endosomes and on the cell surface.
  • Information by UniProt

Images

  • ab161720 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161720 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161720.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up