Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKS GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY RDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFI NGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFP LNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEING QDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDG FWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVE DVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACH VHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMT
    • Molecular weight
      75 kDa
    • Amino acids
      22 to 457

Specifications

Our Abpromise guarantee covers the use of ab168902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to cleave a fluorogenic peptide substrate, Mca-SEVNLDAEFRK (Dpn) RR-NH2, The specific activity is > 1.5 pmoles/min/µg.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    pH: 7.00
    Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names
    • APP beta secretase
    • Asp 2
    • ASP2
    • Aspartyl protease 2
    • BACE
    • BACE 1
    • BACE1
    • BACE1_HUMAN
    • Beta secretase
    • Beta secretase 1
    • Beta site amyloid beta A4 precursor protein cleaving enzyme
    • Beta site amyloid precursor protein cleaving enzyme
    • Beta site amyloid precursor protein cleaving enzyme 1
    • Beta site APP cleaving enzyme
    • Beta site APP cleaving enzyme 1
    • Beta-secretase 1
    • Beta-site amyloid precursor protein cleaving enzyme 1
    • Beta-site APP cleaving enzyme 1
    • FLJ90568
    • HSPC104
    • Memapsin 2
    • Memapsin-2
    • Memapsin2
    • Membrane associated aspartic protease 2
    • Membrane-associated aspartic protease 2
    • Transmembrane aspartic proteinase Asp2
    see all
  • Function
    Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cleaves at the N-terminus of the A-beta peptide sequence, between residues 671 and 672 of APP, leads to the generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated C-terminal fragment which is later released by gamma-secretase.
  • Tissue specificity
    Expressed at high levels in the brain and pancreas. In the brain, expression is highest in the substantia nigra, locus coruleus and medulla oblongata.
  • Sequence similarities
    Belongs to the peptidase A1 family.
  • Domain
    The transmembrane domain is necessary for its activity. It determines its late Golgi localization and access to its substrate, APP.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane. Golgi apparatus > trans-Golgi network. Endoplasmic reticulum. Endosome. Cell surface. Predominantly localized to the later Golgi/trans-Golgi network (TGN) and minimally detectable in the early Golgi compartments. A small portion is also found in the endoplasmic reticulum, endosomes and on the cell surface.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab168902 stained overnight with Coomassie Blue.

References

ab168902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up