Recombinant Human BACH1.3 protein (ab116862)

Overview

  • Product nameRecombinant Human BACH1.3 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO14867
    • SpeciesHuman
    • SequenceNLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEKDKSTPDGELA LPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQMSTATSEQAGPAEQC RQSGGISD
    • Molecular weight38 kDa including tags
    • Amino acids616 to 723

Specifications

Our Abpromise guarantee covers the use of ab116862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BACH 1
    • BACH 1.3
    • Bach1
    • BACH1_HUMAN
    • Basic leucine zipper transcription factor 1
    • basic region leucine zipper transcriptional regulator BACH1
    • BTB and CNC homolog 1
    • BTB and CNC homology 1
    • BTB and CNC homology 1, basic leucine zipper transcription factor 1
    • HA2303
    • OTTHUMP00000096563
    • OTTHUMP00000096564
    • Transcription regulator protein BACH1
    see all
  • FunctionTranscriptional regulator that acts as repressor or activator. Binds, in-vitro, to NF-E2 binding sites. Play important roles in coordinating transcription activation and repression by MAFK.
  • Sequence similaritiesBelongs to the bZIP family. CNC subfamily.
    Contains 1 BTB (POZ) domain.
    Contains 1 bZIP domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human BACH1.3 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116862 at approximately 37.51 kDa.

References for Recombinant Human BACH1.3 protein (ab116862)

ab116862 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"