Recombinant Human BACH1.3 protein (ab116862)

Overview

  • Product name
    Recombinant Human BACH1.3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEKDKSTPDGELA LPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQMSTATSEQAGPAEQC RQSGGISD
    • Molecular weight
      38 kDa including tags
    • Amino acids
      616 to 723

Specifications

Our Abpromise guarantee covers the use of ab116862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BACH 1
    • BACH 1.3
    • Bach1
    • BACH1_HUMAN
    • Basic leucine zipper transcription factor 1
    • basic region leucine zipper transcriptional regulator BACH1
    • BTB and CNC homolog 1
    • BTB and CNC homology 1
    • BTB and CNC homology 1, basic leucine zipper transcription factor 1
    • HA2303
    • OTTHUMP00000096563
    • OTTHUMP00000096564
    • Transcription regulator protein BACH1
    see all
  • Function
    Transcriptional regulator that acts as repressor or activator. Binds, in-vitro, to NF-E2 binding sites. Play important roles in coordinating transcription activation and repression by MAFK.
  • Sequence similarities
    Belongs to the bZIP family. CNC subfamily.
    Contains 1 BTB (POZ) domain.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116862 at approximately 37.51 kDa.

References

ab116862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up